| Rosetta 3.2 Release Manual |
octopus2span.pl <OCTOPUS topology file> example: <path to mini>/mini/src/apps/public/membrane_abinitio/octopus2span.pl BRD4.octopus
Sample OCTOPUS topology file:
############################################################################## OCTOPUS result file Generated from http://octopus.cbr.su.se/ at 2008-09-18 21:06:32 Total request time: 6.69 seconds. ############################################################################## Sequence name: BRD4 Sequence length: 123 aa. Sequence: PIYWARYADWLFTTPLLLLDLALLVDADQGTILALVGADGIMIGTGLVGALTKVYSYRFV WWAISTAAMLYILYVLFFGFTSKAESMRPEVASTFKVLRNVTVVLWSAYPVVWLIGSEGA GIV OCTOPUS predicted topology: oooooMMMMMMMMMMMMMMMMMMMMMiiiiMMMMMMMMMMMMMMMMMMMMMooooooMMM MMMMMMMMMMMMMMMMMMiiiiiiiiiiiiiiiiiiiiiMMMMMMMMMMMMMMMMMMMMM ooo
Sample span file:
TM region prediction for BRD4 predicted using OCTOPUS 4 123 antiparallel n2c 6 26 6 26 31 51 31 51 58 78 58 78 97 117 97 117
1st line is comment line. 2nd line shows number of predicted transmembrane helices (4 in the command lines example below) and total number of residues (123 in the example below). 3rd line shows predicted topology of transmembrane helices in the membrane (currently only antiparallel topology is implemented). 4th line and all lines below show start and end residue numbers of each of the predicted transmembrane helices (current format repeats these numbers twice).
run_lips.pl <fasta file> <span file> <path to blastpgp> <path to nr database> <path to alignblast.pl script> example: <path to mini>/mini/src/apps/public/membrane_abinitio/run_lips.pl BRD4.fasta BRD4.span /work/bjornw/Apps/blast/bin/blastpgp /scratch/shared/genomes/nr ~bjornw/mini/src/apps/public/membrane_abinitio/alignblast.pl
Lipid exposed data: resnum mean-lipo lipophil entropy
6 -1.000 3.004 1.211
9 -1.000 2.268 2.137
10 -1.000 4.862 1.095
13 -1.000 1.304 1.552
16 -1.000 3.328 2.025
...
./bin/membrane_abinitio2.linuxgccrelease
-in:file:native BRD4.pdb Native structure (optional)
(or -in:file:fasta BRD4_.fasta) Protein sequence in fasta format (required if native structure is not provided)
-in:file:spanfile BRD4.span Octopus transmembrane prediction (see above)
-in:file:lipofile BRD4.lips4 Lipophilicity prediction (see above)
-in:file:frag3 aaBRD4_03_05.200_v1_3 3-residue fragments
-in:file:frag9 aaBRD4_09_05.200_v1_3 9-residue fragments
-in:path:database ~minirosetta_database Path to rosetta database
-abinitio:membrane Membrane ab initio application
-score:find_neighbors_3dgrid Use a 3D lookup table for residue neighbors calculations
-membrane:no_interpolate_Mpair Switch off the interpolation between the two layers for the Mpair term
-membrane:Menv_penalties Switch on the following penalties:
* no non-helical secondary structure fragments in predicted transmembrane helical regions in the hydrophobic layer of the membrane.
* no N- and C- termini residues of predicted transmembrane helical regions in the hydrophobic layer of the membrane.
* no transmembrane helices with orientation >45 degrees relative to the membrane normal vector.
-nstruct 1 Number of output structures
There are several optional settings used for Monte Carlo based membrane normal and center search protocol:
-membrane:normal_cycles (default=100) Total number of membrane normal cycles -membrane:normal_mag (default=5) Magnitude of membrane normal angle search (degrees) -membrane:center_mag (default=1) Magnitude of membrane center search (Angstroms)
For more information about membrane ab initio modeling flags, please check the options list
-membrane:normal_cycles 40 -membrane:normal_mag 15 -membrane:center_mag 2
Mpair membrane pairwise residue interaction energy Menv membrane residue environment energy Mcbeta membrane residue centroid density energy Mlipo membrane residue lipophilicity energy Menv_hbond membrane non-helical secondary structure in the hydrophobic layer penalty Menv_termini membrane N- and C-temini residue in the hydrophobic layer penalty Menv_tm_proj transmembrane helix projection penalty
-membrane:center_search (default= false) - perform membrane center search within "center_max_delta" deviation (see below). -membrane:normal_search (default= false) - perform membrane normal search with normal_start_angle, normal_delta_angle, and normal_max_angle values (see below). -membrane:center_max_delta (default= 5 A) - magnitude of maximum membrane width deviation during membrane center search (Angstroms). -membrane:normal_start_angle (default= 10 degrees) - magnitude of starting angle during membrane normal search (degrees). -membrane:normal_delta_angle (default= 10 degrees) - magnitude of angle deviation during membrane normal search (degrees). -membrane:normal_max_angle (default= 40 degrees) - magnitude of maximum angle deviation during membrane normal search (degrees).
Note that by default membrane abinitio, membrane score, and membrane relax protocols will still use Monte Carlo based protocol to search membrane center and normal.
1.5.9